PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_64240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 161aa    MW: 18298 Da    PI: 10.1394
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_64240.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.93.9e-53131421129
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                   lppGfrFhP+d+el+++yL++kv+gk  ++  +  + +vd++kvePwdLp +++ + kewyf+s +d+kyatg+r+nrat sgyWkatgkd+ v + 
  MLOC_64240.1  13 LPPGFRFHPRDDELICDYLAPKVTGKVgFSGRRPpMVDVDLNKVEPWDLPVTASVGGKEWYFYSLKDRKYATGQRTNRATVSGYWKATGKDRVVAR- 108
                   79************************986665656***************8888899***********************************9999. PP

           NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                   +g+lvg++ktLvfy+grapkg+kt+Wvmheyrle
  MLOC_64240.1 109 RGALVGMRKTLVFYQGRAPKGRKTEWVMHEYRLE 142
                   999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-552154IPR003441NAC domain
PROSITE profilePS5100550.61813161IPR003441NAC domain
PfamPF023651.9E-2714141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MSMSFLSMVE TELPPGFRFH PRDDELICDY LAPKVTGKVG FSGRRPPMVD VDLNKVEPWD  60
LPVTASVGGK EWYFYSLKDR KYATGQRTNR ATVSGYWKAT GKDRVVARRG ALVGMRKTLV  120
FYQGRAPKGR KTEWVMHEYR LEGAHEQASK VIADTKTLDH A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-47914111140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2504750.0AK250475.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf77e13, mRNA sequence.
GenBankAM5008550.0AM500855.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (nac1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237041.11e-103PREDICTED: NAC domain-containing protein 21/22-like isoform X1
SwissprotQ84TE64e-73NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLM0XYQ91e-118M0XYQ9_HORVD; Uncharacterized protein
STRINGMLOC_64240.21e-109(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.22e-74NAC domain containing protein 1